PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_21390_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 315aa    MW: 35727.1 Da    PI: 6.3485
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_21390_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-092412771955
                                           HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                              Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                            +k +yps++++  LA+++gL+++q+ +WF N+R ++
  cra_locus_21390_iso_2_len_1023_ver_3 241 HYKWPYPSETQKLALAESTGLDQKQINNWFINQRKRH 277
                                           44679*****************************885 PP

2ELK41.43.1e-14197218122
                                   ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                           ELK qLlrKYsgyLgsLkqEF+
  cra_locus_21390_iso_2_len_1023_ver_3 197 ELKGQLLRKYSGYLGSLKQEFM 218
                                           9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.6E-2056100IPR005540KNOX1
PfamPF037902.2E-225896IPR005540KNOX1
SMARTSM012561.6E-26107158IPR005541KNOX2
PfamPF037913.7E-21110156IPR005541KNOX2
PROSITE profilePS5121311.174197217IPR005539ELK domain
SMARTSM011882.8E-8197218IPR005539ELK domain
PfamPF037895.0E-11197218IPR005539ELK domain
PROSITE profilePS5007113.119217280IPR001356Homeobox domain
SMARTSM003894.1E-13219284IPR001356Homeobox domain
SuperFamilySSF466899.84E-20219291IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-28222282IPR009057Homeodomain-like
CDDcd000861.42E-12229281No hitNo description
PfamPF059208.9E-17237276IPR008422Homeobox KN domain
PROSITE patternPS000270255278IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
ATSNQNNHRQ PPSNSMMLQQ QQEDSHHNNN VVTAATAVGC YFMDDNINNI DGSSSNSVKA  60
KIMSHPHYHR LLAAYINCQK IGAPPDVVAR LEEACSSAAA TMVRSSSSSC IGEDPALDQF  120
MEAYCEMLTK YEQELSKPFK EAMLFLSRIE CQFKALSLAT SSHDSAMAEA AVDRNGSSEE  180
DVDVNNSFVD PQAEDRELKG QLLRKYSGYL GSLKQEFMKK RKKGKLPKEA RQQLLDWWEK  240
HYKWPYPSET QKLALAESTG LDQKQINNWF INQRKRHWKP SEDMQFVVMD ATQSHYYMDN  300
VLGNPFPMDI SPALL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212221LKQEFMKKRK
2218222KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518420.11e-166PREDICTED: homeobox protein SBH1
SwissprotP466081e-148HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A068U8C31e-170A0A068U8C3_COFCA; Uncharacterized protein
STRINGVIT_10s0116g00190.t011e-163(Vitis vinifera)